PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009610189.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 731aa    MW: 79490.4 Da    PI: 6.5496
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009610189.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.89.7e-33314371260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     +DgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkvers+ +++++ei+Y+g Hnh+k
  XP_009610189.1 314 EDGYNWRKYGQKQVKGSEYPRSYYKCTHPNCPVKKKVERSH-EGHITEIIYKGAHNHPK 371
                     8****************************************.***************85 PP

2WRKY104.17.4e-33528586159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vkg+++prsYY+CtsagC+v+k+ver+++d k v++tYeg+Hnh+
  XP_009610189.1 528 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSAGCNVRKHVERASHDLKSVITTYEGKHNHD 586
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.3E-29311372IPR003657WRKY domain
SuperFamilySSF1182909.29E-26312372IPR003657WRKY domain
SMARTSM007749.0E-37313371IPR003657WRKY domain
PROSITE profilePS5081123.399314372IPR003657WRKY domain
PfamPF031062.9E-25314370IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.4E-37513588IPR003657WRKY domain
SuperFamilySSF1182901.44E-28520588IPR003657WRKY domain
PROSITE profilePS5081138.733523588IPR003657WRKY domain
SMARTSM007746.6E-38528587IPR003657WRKY domain
PfamPF031065.0E-25529586IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0009942Biological Processlongitudinal axis specification
GO:0030010Biological Processestablishment of cell polarity
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 731 aa     Download sequence    Send to blast
MGGFDDHVAI MGDWMPPSPS PRSFFSSLLG DDIGSRSTFE FPNENQRGNL ASEPQEHVGI  60
SDGAQADATT VKSDQKMSSR GGLLERMAAR AGFNAPKLNT ESLRPADLSQ NQGVRSPYLT  120
IPPGLSPTSL LESPVFLSNS LVQPSPTTGK FQFASGIESR NSTFMMEDPD KRKENALESI  180
NSSSFSFKPV PETAPSLFPG TTSRSWLQVN SSNISQQCFP NIKVSVHSQN SLLSHSVEAT  240
QMQTQSEKGL HQSSDFPRFS AEKGVRDSNV TPESRNFQSV GSNMEHSPPL DEPQDEEIDQ  300
RVGGDPNVVG APAEDGYNWR KYGQKQVKGS EYPRSYYKCT HPNCPVKKKV ERSHEGHITE  360
IIYKGAHNHP KPPPNRRSAL GSTNSLGELQ LDGAEQGVSG SNGDLGRANI QKAPDAGGLD  420
WRNNNLDVTS SAHLGSAYCN GSASFPVQNN TQLESGGAVD VSSTFSNDED EDDRGTHGSV  480
SQGYDGEGDE SESKRRKLET YSTDMSGATR AIREPRVVVQ TTSEVDILDD GYRWRKYGQK  540
VVKGNPNPRS YYKCTSAGCN VRKHVERASH DLKSVITTYE GKHNHDVPAA RNSSHVNSGA  600
SNTLPAPVTA PPAQSHLHRP EPAQLQNAMA RFDRQPSLGS FGPTPGYSYG INQQGLASLA  660
MAGFHPNQSK SQQQIPVHSY LGQPRPMHDG GFMFPKEEPK AEPMSDPGLD LSNGSSIYQQ  720
FMSRLPLGPQ M
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-37314589878Probable WRKY transcription factor 4
2lex_A6e-37314589878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00071PBMTransfer from AT5G56270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0635760.0AB063576.1 Nicotiana tabacum NtWRKY-9 mRNA for WRKY DNA-binding protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009610187.10.0PREDICTED: probable WRKY transcription factor 2 isoform X1
RefseqXP_016456273.10.0PREDICTED: probable WRKY transcription factor 2 isoform X1
SwissprotQ9FG770.0WRKY2_ARATH; Probable WRKY transcription factor 2
TrEMBLQ94IB30.0Q94IB3_TOBAC; WRKY DNA-binding protein
STRINGPGSC0003DMT4000569520.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.11e-178WRKY DNA-binding protein 2